Automated Data Reduction
New! I have now set up a mailing list for xia2 on sourceforge.
If you would like to subscribe to this - where announcements of new
versions of xia2 and problems can be discussed, please go to
the list
page. Also, if you are interested in keeping up-to-date with what
is going on in xia2 development take a look at the
blog.
xia2 is a new automated data reduction system designed to work from raw
diffraction data and a little metadata, and produce usefully reduced
data in a form suitable for immediately starting phasing and structure
solution, e.g. through Mr BUMP or your favourite experimental phasing
suite.
The following steps are performed (although not strictly in
this order)
- Integration with feedback and complex lattice selection stuff
- Reindexing to standard setting for spacegroup (e.g. P 2 21 21 to
P 21 21 2)
- Scaling together of all data to maximise anomalous signal
- Estimation of number of molecules in ASU and solvent fraction
based on sequence information (if provided)
There is a lot of fun stuff which goes on in there - run it to find
out more...
The system is designed to cope with MAD data and data measured in
multiple passes, or a combination of the two. The input is a therefore
a little complex, but consists only of information you should have
to hand anyway - here is a simple example, a more complex example
can be found below.
Download
The current version, 0.3.4.0 can be obtained by following these
links:
All of the files are the same, simply packed for different platforms.
Installation
Since everything is precompiled, the only requirement is to unpack the
directory somewhere and edit the directory setup.bat, setup.csh or
setup.sh appropriately, for instance setting XIA2_HOME as
/opt/px/xia/xia-0.3.4.0 if you unpacked the tarball in /opt/px/xia.
Note that this includes the xia-0.3.4.0 directory!
All that is then needed is to source this setup file and the application
xia2 should be available. One more recent change is that I am using
CCTBX python, which needs to be more recent than the version included
(currently) in CCP4 - downloading an update from cctbx.sourceforge.net
and reading the setup file after the CCP4 one works fine.
Also loading any recent PHENIX installation should work fine.
Input
There are two ways of running xia2 - with and without an input file,
an example of which follows below. If you just run
xia2 /my/data/are/here
xia2 will do something sensible - in this case process all of the data,
scale all measurements as if they are from a single crystal and merge
the data from each wavelength separately. If only one wavelength is present
xia2 will assume that the data are a native data set - to separate
anomalous pairs provide a heavy atom (at this time it doesn't matter
what it is...) i.e.
xia2 -atom se /my/data/are/here
Other options are (type just xia2 to get this list)
Command-line options to xia2:
[-2d] or [-3d] or [-3dii]
[-parallel 4] (say, for XDS usage)
[-resolution 2.8] (say, applies to all sweeps)
[-freer_file free.mtz]
[-quick]
[-atom se] (say)
[-reversephi]
[-migrate_data]
[-beam x,y]
Running ths way some assumptions are made:
- All images are from one crystal only.
- The scan, if present, was the one used to select the wavelengths
for data collection. If more than one is present, the alphabetically
latest one will be used.
- The sequence file, if present, should be in the one letter form
and all comment lines should begin with a character not in A-Z.
Again the alphabetically latest sequence file will be used.
- If the sequence file is provided, and the atom is "se", then
xia2setup will assume that you are doing a SeMet experiment
and will provide an appropriate number of atoms per monomer - though
you will still have to uncomment this to include it,
in case it has guessed wrong.
If you want to combine data from a number of crystals in the same
.xinfo file, then you will need to copy out all text from
BEGIN CRYSTAL to END CRYSTAL from one .xinfo file to the other.
You should then load automatic.xinfo in your favourite editor, and
check that the sequence looks correct and that the names are sensible
as well as checking that the epoch numbers are set correctly and
also that the wavelengths and beam centres are correct. If you
provided a heavy atom there is a place to say how many to look for.
Finally, if you have labelit installed xia2 will run this
to update the beam positions. If this happens, you will see a comment
to this effect above the BEAM records in the sweeps.
The other mechanism for running xia2 is via a xinfo file, which
explains the layout of the data set to xia2 explicitly. This is helpful
if you wish to only process a subset of the measurements, or want to
process data for an RIP experiment. A simple example of xinfo file
follow below, and more complex examples can be found here:
More examples can be found in $XIA2_ROOT/examples. Remember - you need
to tell xia2 where to find your data! Answers to frequently asked
questions can be found here.
! This is a demonstration .xinfo file which illustrates how to cope
! with a simple case - this example is a native cubic insulin data
! set measured on 14.2 at the SRS
BEGIN PROJECT DEMONSTRATION
BEGIN CRYSTAL INSULIN
BEGIN AA_SEQUENCE
! this is only really needed at the moment for assessing the solvent
! content and number of residues in the asu
GIVEQCCASVCSLYQLENYCN
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
END AA_SEQUENCE
BEGIN WAVELENGTH NATIVE
! this doesn't have to be here - if it is
! not included then the values from
! the image headers will be used - however
! if it is there then it should
! be correct!
WAVELENGTH 0.979000
! in here you can also have
! F' value
! F'' value
END WAVELENGTH NATIVE
BEGIN SWEEP NATIVE
WAVELENGTH NATIVE
IMAGE insulin_1_001.img
! you will probably need to change this -
! this is the only thing which
! you will need to change for the
! demonstration data set
DIRECTORY /media/data1/graeme/demo/
! additionally you can add the following
! information - if it is wrong in the headers
! BEAM x y (mm)
! DISTANCE z (mm)
! this describes the order in which
! the sweeps were collected -
! it usually comes from the image header
! if that information is in there
! EPOCH 5
! you can also add this to only reduce
! a subset of the data
! START_END 1 30 (image numbers)
END SWEEP
END CRYSTAL INSULIN
END PROJECT DEMONSTRATION
Demonstration Data: Cubic Insulin
This uses test images which are available from the links below.
Thanks to John Cowan for providing this test data!
Platforms
The following platforms are supported (see notes at bottom of page
for platform specific advice.)
- GNU/Linux on i386 (and 64 bit extensions)
- OS X 10.4 i386 and Power PC G4/G5
- Microsoft Windows 2000/XP (Vista doesn't work - problem with
the mosflm SPOTOD file - currently investigating)
Supported Detector Types
The following detectors are supported:
- ADSC CCD detectors
- MAR CCD detectors
- MAR 345 image plates
- RAXIS IV image plates
- Rigaku Saturn CCDs (Binned and unbinned)
- Pilatus 6M detectors
If you have another detector class which needs support, please get
in touch.
Requirements
The only software which is actually required is CCP4 6.0.1/2 and Python
2.4.x. On Windows the PyWin32 module is also required, to provide
additional process control functionality. If you are using this
on a Windows platform and wish to be able to use the integration
functionality, you should get in touch with Harry Powell for a custom
build of Mosflm.
In addition the autoindexing program Labelit is supported but the
system will work without it. If it is installed (and it should be a
moderately recent version) then it will be used for autoindexing.
License
This software is distributed under the BSD license for all users.
Everyone who uses this software is invited to join the xia2bb
mailing list. Finally, if you use this software in solving a structure
which is published, please acknowledge it! Thanks!
A copy of the license is available here
.
This software depends apon CCP4 and will also make use of Labelit -
users are reminded that it is their responsibility to have properly
obtained licenses for this software.
Usage
Once the software is installed, the first thing you need to do is
prepare a .xinfo file (example above) to run from. This contains a
description of the experiment, which will allow xia2 to decide how to
handle your data and what information to put in the MTZ headers.
Essentially the input file just needs a description of the data
which were collected from each crystal - for instance, if you measured
three MAD wavelengths, a peak, inflection and high remote, then
there should be three WAVELENGTH blocks in the file, containing the
fp, fpp and wavelength values. The images that you measured from these
should then be described in the SWEEP block, which is then assigned to
a wavelength. This structure simplifies handling of multiple passes
contributing to one wavelength. In the reduced output, the wavelength
names will correspond to MTZ datasets. If you are interested in
keeping the harvesting information, and you have more than one crystal
to process in a single xia2 run, you will need to ensure that the
WAVELENGTH names are globally unique within the input file.
The program is actually run with:
xia2 -xinfo project.xinfo
And all data reduction is performed in the working directory, with the
a directory structure CRYSTAL/WAVELENGTH/SWEEP. Interesting log files
can be found in the CRYSTAL/scale directory.
Acknowledgements
Development of xia2 is supported by the BBSRC e-HTPX grant and the
EU framework 6 BioXHit initiative. xia2 makes extensive use of Phil
Evans's program Pointless, and I would like to thank him for the
extensive modifications made to the program. I would also like to thank
the US structural genomics JCSG group for providing their extensive
collection of raw diffraction data to methods developers. Finally I
would like to acknowledge CCP4, for without their software this project
would go nowhere!
The More Complex Example
This example has two crystals, one of which is selenomethionated,
with two wavelengths (inflection and low remote) measured for the
derivative and two native sweeps measured for the native sample.
Lines beginning with # or ! will be treated as comments.
BEGIN PROJECT TS01
BEGIN CRYSTAL 12847
BEGIN AA_SEQUENCE
MKVKKWVTQDFPMVEESATVRECLHRMRQYQTNECIVKDREGHFRGVVNKEDLLDLDLDSSVFNKVSLPD
FFVHEEDNITHALLLFLEHQEPYLPVVDEEMRLKGAVSLHDFLEALIEALAMDVPGIRFSVLLEDKPGEL
RKVVDALALSNINILSVITTRSGDGKREVLIKVDAVDEGTLIKLFESLGIKIESIEKEEGF
END AA_SEQUENCE
BEGIN WAVELENGTH NATIVE
WAVELENGTH 0.99187
END WAVELENGTH NATIVE
! high resolution native pass
BEGIN SWEEP NATIVE_HR
WAVELENGTH NATIVE
BEAM 109.0 105.0
IMAGE 12847_4_001.img
DIRECTORY /Volumes/Arthur/JCSG Data/1vr9/data/jcsg/als1/8.2.1/20050121/collection/TM0892/12847/
END SWEEP NATIVE_HR
! low resolution native pass
BEGIN SWEEP NATIVE_LR
WAVELENGTH NATIVE
BEAM 109.0 105.0
IMAGE 12847_5_001.img
DIRECTORY /Volumes/Arthur/JCSG Data/1vr9/data/jcsg/als1/8.2.1/20050121/collection/TM0892/12847/
END SWEEP NATIVE_LR
END CRYSTAL 12847
BEGIN CRYSTAL 13140
BEGIN AA_SEQUENCE
MKVKKWVTQDFPMVEESATVRECLHRMRQYQTNECIVKDREGHFRGVVNKEDLLDLDLDSSVFNKVSLPD
FFVHEEDNITHALLLFLEHQEPYLPVVDEEMRLKGAVSLHDFLEALIEALAMDVPGIRFSVLLEDKPGEL
RKVVDALALSNINILSVITTRSGDGKREVLIKVDAVDEGTLIKLFESLGIKIESIEKEEGF
END AA_SEQUENCE
BEGIN HA_INFO
ATOM SE
NUMBER_PER_MONOMER 5
END HA_INFO
BEGIN WAVELENGTH INFL
WAVELENGTH 0.979741
F' -10.0
F'' 3.2
END WAVELENGTH INFL
BEGIN WAVELENGTH LREM
WAVELENGTH 1.019859
F' -2.6
F'' 0.55
END WAVELENGTH LREM
BEGIN SWEEP INFL
WAVELENGTH INFL
BEAM 108.7 102.0
IMAGE 13140_1_E1_001.img
DIRECTORY /Volumes/Arthur/JCSG Data/1vr9/data/jcsg/als1/8.3.1/20050105/collect/TM0892/13140/
END SWEEP
BEGIN SWEEP LREM
WAVELENGTH LREM
BEAM 108.7 102.0
IMAGE 13140_1_E2_001.img
DIRECTORY /Volumes/Arthur/JCSG Data/1vr9/data/jcsg/als1/8.3.1/20050105/collect/TM0892/13140/
END SWEEP
END CRYSTAL 13140
END PROJECT TS01
This is a particularly complex example, but it illustrates the
capability of the system well. There are data from two cystals, one
native and the other selenomethionated. The native set is measured in
two sweeps. Currently (version 0.3.4.0) no attempt is made to
intelligently combine data from multiple crystals, however this is on
the to-do list.
Release Notes
Changes since 0.3.3.4
- Use Phil to override XDS parameters.
- Use Pointless in place of Reindex; Aimless in place of Scala; no
limit to number of batches which can be processed.
Changes since 0.3.3.3
- Fixed bug in polarization correction vector for Pilatus data.
- Fixed bug relating to assigning spacegroup on command-line.
- Begun work on supporting Pilatus 300K for small molecule
crystallography. Have now successfully processed data from Diamond
Light Source beamline I19 EH2. N.B. Only works -3dii!
Changes since 0.3.3.2
- Many bug fixes as a result of implementing a comprehensive testing
`scheme.
- Support for full cbf format, making use of cbflib Python bindings
pycbf now included in cctbx releases.
- Merged functionality from XDSIntegraterR into XDSIntegrater, removed
duplicate code. Will make for more maintainable suite in the future.
- Improved 2d pipeline scaling, now tests 8 permutations.
- Improved handling of twinned data for multiple sweeps.
- Fixed occasional bugs with multiple sweeps, reindexing trigonal
data sets with XDS.
- Removed "old" scaling modes, 2d and 3d, as these were unhelpful.
Changes since 0.3.3.1
- -xparallel -1 option added which will split your data into 30 degree
chunks and process with forkintegrate Note well you are responsible
for setting up forkintegrate correctly!
Changes since 0.3.3.0
- Handle division in updated CCTBX.
- Squash bug with -3d and -resolution.
- Squash bug with resolution and -2d, result slightly different to
that reported.
- Trap weirdness with XDS reindexing, causes problems sometimes
trying to process in C2 from P222 not P2 as you would hope!
- Adjustments to cope with excludively narrow sweeps i.e. all 3
image sweeps.
Changes since 0.3.2.0
- Support for new XDS build.
- Small bug fix / improvement in XDS indexer implementation.
- Capability to ptovide refined experimental geometry via
XDS GXPARM.XDS - useful for polycrystal data reduction.
- Now check what you tell the program, viz:
gw56@ws050 nonsense]$ xia2 -3d -nonsense /data/gw56/dl/Cowan/Insulin/insulin/
Traceback (most recent call last):
File "/home/gw56/svn/xia2/Applications/xia2.py", line 45, in
from xia2setup import write_xinfo
File "/home/gw56/svn/xia2/Applications/xia2setup.py", line 35, in
from Handlers.CommandLine import CommandLine
File "/home/gw56/svn/xia2/Handlers/CommandLine.py", line 1513, in
CommandLine.setup()
File "/home/gw56/svn/xia2/Handlers/CommandLine.py", line 349, in setup
raise RuntimeError, nonsense
RuntimeError: Unknown command-line options: -nonsense
and complain if you type in something xia2 does not understand.
- Removed a lot of cruft from the xia2 code base in preparation
for some more substantial refactoring.
- Found bug which meant that the labelit beam centre computed in the
setup phase was not used - mostly this is not important, unless you are
using -3dii.
- Added -ice command-line argument, which will exclude measurements
from regions which are typically where ice rings land. Will need to
add more subtle mechanism which will allow specific regions to be
excluded.
- Specifying resolution with 3d(r) pipeline now works correctly.
- Removed XDS version check by default, which was annoying every new
year. If you would like to check that the XDS version is explicitly
supported, add -check_xds_version to the command-line.
- Added table of scala runs to sweep name in the debug output, helpful
for reviewing in polycrystal data reduction cases.
- Mosaic spread used from Mosflm is now average of all images, not the
first or last image.
- Fixed header reading for new Pilatus instruments at DLS and
elsewhere.
- Added capacity to pass in known globally postrefined experimental
setup via -xparm GXPARM.XDS, only useful with XDS processing
pipelines.
- Removed use of ccp4 printpeaks tool, which crashes on new pilatus
images, replace with Mosflm for the moment. Move to replacement with
labelit code at later stage planned.
Changes since 0.3.1.7
- Now report the min, mean, max mosaic spread (according to the
program definitions after integration of each sweep.
- Resolved problems with overriding environment.
- Added -serial pun for -parallel 1.
- Allow resolution limit to be assigned on a per-sweep basis.
- Handled corner case with images 200 - 250 (say) giving REBATCH
error.
- Added full 8-way search for scaling models for 2d pipelines.
- Partial support for two-theta offset data collection (tested with
Rigaku X-ray equipment and Diamond I19 data.)
- Added -min_images keyword which is helpful when analysing virus data
with e.g. 4 images / sweep.
Changes since 0.3.1.6
- Changes suitable for working on microcrystals - reachable through
a -microcrystal command line flag, and -failover is probably helpful
too.
- If lattice or spacegroup specified, do not run tests.
- 2dr and 3dr now the default pipelines - use 2dold or 3dold if you
need to get to the old pipelines.
- Fixed selection of known lattice in IDXREF reindexing.
Changes since 0.3.1.0
- Fixed bug where the resolution limit was not reset in an indexer
solution elimination.
- Added support for XDS from Dec 09.
- Fixed some of the issues found in the resolution limit determination
when processing low resolution data.
- Fixed use of I/sigma limit assignment.
- Added command-line control of individual indexer, integrater,
scaler.
- Repaired regular expression for image matching, to cope with
images where there is e.g. 3.5 in the template. This was previously
misinterpreted as an image name of the form setup.NNNN.
- Implemented new resolution limit pipelines, based on new merging code
to give more robust control: -2dr and -3dr (recommended.) Fine
control over the choices can be made using the -isigma, -misigma,
-completeness and -rmerge command line options.
- Added interactive indexing mechanism, where user can assign images
to use for autoindexing, e.g.:
Existing images for indexing: 1, 90, 180
>1, 60, 120, 180
New images for indexing: 1, 60, 120, 180
Assign -interactive on the command line (Mosflm and Labelit indexers)
Changes since 0.3.0.6
Changes since 0.3.0.5
- No lattice test mode added (you can guess the command-line option)
for tricky data sets where this perhaps falls over.
- Fixed side effect of changes which allowed setting of unit cell
etc. - lattices were no longer eliminated, failed complaining
can't eliminate only solution.
- Tidied up the generation of output files and so on - now only have
the main log file and the debug trace.
- Added copy of the command line to program output.
Changes since 0.3.0.4
- Now able to specify number or fraction of reflections assigned to
the free set, rather than the default 5 percent.
- Added trap for sdcorrection not being refined in XDS correct if
multiplicity rather low. Unusual case.
- Assigning a freer_file by definition sets this as an indexing
reference and also copies the spacegroup assignment. This is
what you would expect!
Changes since 0.3.0.3
- User now able to assign cell constants: use with great care, as
there is little in the way of nonsense trapping. This may however
be used to handle cases where the solution you want is monoclinic
with a pseudo-orthorhombic lattice, where the default indexing would
select a different setting. This will not currently work with a
Mosflm indexer. Usage is:
-cell a,b,c,alpha,beta,gamma
and the correct symmetry should also be assigned. Can also assign
USER_CELL a b c alpha beta gamma in the xinfo file.
Changes since 0.3.0.0
- Now automatically determine the number of available processor
cores.
- Implemented check for centring of crystallographic basis from
autoindexing.
- Started to use CCTBX - this will be bundled with the release
from now on...
- Now runs "smart scaling" i.e. will customise the scaling model
used to the data. This can seriously improve the xia2 run time in
cases where some of the default scaling models do not converge.
- Now also includes running of CHEF for radiation damage, which will
slice and dice your data into dose groups, then run a correctly
time sequenced radiation damage analysis. N.B. for data measured in
"dose mode" the doses will be scaled to < 1,000,000 to ensure that
the output is tidy.
- Corner case of running XDS pipelines from data from a Rigaku setup.
The low resolution was previously calculated to be 0.0! D'oh!
- Added access to reference reflection file functionality to the
command line - -reference_reflection_file foo.mtz.
- Fixed the use of the -image command-line option. Now works.
- Removed all of the binaries from the distribution, so now
you need to be using CCP4 6.1.0 or later!
- Will correctly handle reindexing with the 3d pipeline (XDS/XSCALE)
with trigonal spacegroups and multiple sweeps.
Changes since 0.2.7.2
- Fixed merging statistics bug - I/sigma output were very slightly
different.
- Now extend FreeR column if copying from lower resolution input
file.
- Detector limits now correctly specified around the detector centre
for Mosflm, rather than the beam centre. Only useful if your beam
centre is a fair way from the image centre...
- Parallelised integration with Mosflm - divides the sweeps into an
appropriate number of chunks and then sorts together the resulting
reflection files. -parallel N, remember.
- Added a putative 'small molecule' mode, which will autoindex with
Mosflm from a modest number of images, for smaller molecules where
Labelit is unhappy with the number of good Bragg reflections.
Changes since 0.2.7.0
- Fixed to work correctly with XDS and Rigaku Saturn/RAXIS
detectors.
- Better determination of resolution limits.
- Correct merging of data from XSCALE (needs to invert the I=F*F
scale factor...)
- Fixed output of scalepack unmerged output using 3d pipeline.
- Use fewer frames for background calculation with 3dii pipeline -
speeds things up a fair amount.
- Write chef output files with correct SD correction parameters.
- Print SD correction factors for scala runs - if these are bigger
than about 2 there is something properly wrong. Also print the
same from XDS CORRECT step.
Changes since 0.2.6.6
Changes since 0.2.6.5
- Now supports CCP4 6.1 (forthcoming release) though you may need
to add XIA2_CCP4_61=1 to your environment. This release should include
xia2.
- Added -user_resolution keyword, also support for this on a
per-wavelength basis in the xinfo file.
- Added support for reverse-phi data collection - either add
reversephi to the xinfo file or -reversephi to the command line.
Changes since 0.2.6.4
- Now handles complex image names with e.g. + in them correctly.
- New option for processing
-3dii
added - this will run
the 3D pipeline (XDS, XSCALE) using all images for spot picking and
autoindexing - useful for properly tricky cases.
- Now correctly propogate the profile information to Mosflm when not
using Mosflm for autoindexing - this is done by running a "fake"
autoindexing task.
- Use the raster information for the cell refinement test, and changed
the selection of images for this.
- Added support for the output of BioXHIT XML in the LogFiles
directory - for project tracking.
- Now copy the XDS log files ("LP" files) into the LogFiles
directory - as always these are the most up-to-date versions from
processing.
- Added support for latest release of XDS (June 2, 2008.)
Changes since 0.2.6.3
Changes since 0.2.6.2
Changes since 0.2.6.1
- Now carefully select the images to use for cell refinement based
on the orientation of the crystal lattice.
- Fixed numerous bugs to do with the naming of the detector class
which changed in the previous version.
Changes since 0.2.6.0
- Fixed bug where if the distance was read incorrectly from the
image header (or was wrong therein) XDS would get the wrong value
even if you had put the correct value in the .xinfo file.
- Now "unroll" the unmerged reflections from XSCALE and then
merge them in their original sweeps in Scala. This should give
a useful Rmerge vs. time plot.
- Including updated versions of Pointless and Scala.
- Includes new and more robust handling of pointgroups, lattices
and unstable refinement of parameters during integration.
- Include support for a reference reflection file, which will
ensure that the reflections are indexed in the same way and
with the same spacegroup - useful for mutants.
- Now always use three wedges of images for the cell refinement
with Mosflm as this makes the lattice elimination more reliable.
- If one of the images in a sweep is broken (e.g. corrupted)
xia2 will tell you more helpfully rather than just crashing.
- Now correctly read distance from Mar 165 images. Thanks to
Francois Remacle for this fix to DiffractionImage.
- Fixed the use of xia2 -3d with RAXIS IV detectors.
- Use more images for Mosflm autoindexing (three instead of two)
as this gives uniformly better results.
Changes since 0.2.5.2
Changes since 0.2.5.1 - big changes in bold
- Process data as native if no heavy atom information, only one
wavelength specified and no anomalous scattering form factors
provided. Otherwise separate anomalous pairs for scaling.
- Added a -quick option to the xia2 command line, which will
cut out many of the data reduction optimisation steps (not
refine detector parameters, resolution or scaling parameters)
but will still include everything else. This is to allow quick
characterisation of data at the beamline, and perhaps map
calculation?
- Correctly print the unmerged scalepack file name for single
wavelength data.
- Perform radiation damage analysis using R merge and B factor
as a function of time - note that this is not batch.
This is likely to have interesting side-effects.
- If time of data collection not recorded in header but
the time stamp for the images are correct (e.g. you have not moved
them since collection) then the command line flag
-trust_timestamps
can be used, which will use the
time stamps on the image files to analyse things like radiation
damage.
- If you are running this on a cluster, have added an option
to migrate the diffraction data to a local disk (e.g. /tmp.)
To do this add
-migrate_data
to the command line -
the data will be removed from the local disk once the processing
is finished.
- Copy all final reflection files to a DataFiles directory.
- Now, when something goes horribly wrong, just write the actual
message to the screen and the horrible stack trace gunk to a file
called xia2.error. This should be sent in for error reports!
- Remerge individual wavelengths to get the merging statistics to
the most appropriate resolution limit, rather than the furthest
extent of any data, for the summary table.
- If GAIN included in SWEEP block, will be used as the default
value for integration. E.g. GAIN 0.25.
Changes since 0.2.5
Changes since 0.2.4
- xia2setup will now add the f', f'' values if a scan is available
and has been processed by chooch
- GAIN now estimated by diffdump - enabling future parallelisation
of the integration stage.
- For detectors formed as a mosaic of a number of tiles, with "gaps"
in between, now mask those gapped areas in Mosflm to reduce the
number of bad reflections.
- Now has a fix for the ongoing indexing problem which gave rise
to errors like "something horrible has happened in indexing".
- The "best" log file for each process will now be recorded in a
LogFiles directory - which means no more hunting around for the
final scala log file and what not.
- Chaling now produces unmerged reflection files in scalepack format
as well as merged scalepack and merged MTZ format. This is done by
scala (if used) by recycling the final SCALES and adding
"output polish unmerged."
- Now runs a twinning test using the CCP4 program sfcheck, and
will warn you if your data look twinned.
- Now allow up to 100 cycles of scale refinement to cope with
more extreme cases where data at very different resolutions
are scaled together.
Changes since 0.2.3
- Added preferences file
- Added xia2setup program to create the .xinfo file - this will
also run LABELIT to configure the beam centre if it is installed
- Added a strategy-of-data-reduction step to the pipeline
- Added run-time check that CCP4 and so on are available
Changes since 0.2.2.4:
- Changed to a BSD license
- Added "python setup" check to xia2
- Relaxed criteria on isomorphism to 1% not 0.5A etc.
- Now wavelengths in wavelength record will override header
values if provided, but do not (indeed, should not) be included
if wavelength values are correct.
Changes since 0.2.2.3:
- Created version for Power PC G4/G5
- Fixed .csh setup scripts
- If wavelength values not specified in the .xinfo file will use
values from the image headers
- If loggraph output from scala is broken by having Mn(I/sigma)
greater than 99.99 can now cope (ignores that record)
- Will now use a maximum of 180 degrees of data for deciding
e.g. the point group, spacegroup and correct indexing standards -
this helps the cases where exceptionally high redundancy data
has been measured
Changes since 0.2.2.2:
- Updated printheader to cope with MAR 165
- Cleaner error messages when data missing
- Added support for MAR image plate data
- Included more example .xinfo files in the examples directory
- Relaxed refinement parameters in Mosflm cell refinement
Platform Specific Advice
Gfortran compiled CCP4
Recent versions of the gcc compiler suite have included a new compiler
called "gfortran" in place of "g77". This has, unfortunately, been
designed with buffering too high on the agenda, and the output
from programs can sometimes be mashed. If this happens you need to
set "GFORTRAN_UNBUFFERED_ALL" to 1 in your environment.
Linux
There should be no particular problems on this platform - assuming
that you have a recent version of Python. Any 2.4 version should work,
but I have mostly used 2.4.3 and 2.4.4, and would recommend them.
If the version you have on your system by default (type "python"
to find out what version you have)is too old, you can easily install
a new version, perhaps in the xia directory, from
here.
This is best installed by unpacking the tarball (tar xvfz
Python-2.4.4.tgz) then doing ./configure /where/I/want/it then
make, make install.
OS X.4 - X.6
The only potential problem with this platform is that the Python
which comes as standard is 2.3 - however since you need cctbx.python
anyway the problem has gone away.
Windows XP
Once more you will need a recent version of Python - which can be found
here,
however, you will also need "pywin32" to provide a little more
job control functionality - this is available from
here. Both are
simple, double-click, binary installers.
There is now a version of Labelit available for Windows, which
can be found here.
The mosflm binary which comes with
iMosflm works well with xia2.